Analytical Data
-
Gene name
OR8G1
- Application
-
Alternative Names
OR8G1; OR8G1P; Olfactory receptor 8G1; Olfactory receptor OR11-281; Olfactory receptor TPCR25
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15617
-
Expression Region
1-311 aa
-
AA Sequence
MSGENNSSVTEFILAGLSEQPELQLPLFLLFLGIYVVTVVGNLGMTTLIWLSSHLHTPMY YFLSSLSFIDFCHSTVITPKMLVNFVTEKNIISYPECMTQLYFFLVFAIAECHMLAAMAY DRYMAICSPLLYSVIISNKACFSLILGVYIIGLVCASVHTGCMFRVQFCKFDLINHYFCD LLPLLKLSCSSIYVNKLLILCVGAFNILVPSLTILCSYIFIIASILHIRSTEGRSKAFST CSSHMLAVVIFFGSAAFMYLQPSSISSMDQGKVSSVFYTIIVPMLNPLIYSLRNKDVHVS LKKMLQRRTLL
-
Molecular Weight
34.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR8G1, a member of the olfactory receptor family, has gained attention in recent years due to its potential roles in sensory perception and its implications in identifying odorant molecules. As a G protein-coupled receptor (GPCR), OR8G1 is involved in the transduction of chemical signals into neural responses, making it a critical component for the sense of smell. The reconstitution of OR8G1 as a recombinant protein allows researchers to study its structure, function, and interactions with various ligands in a controlled environment. Understanding the functional dynamics of OR8G1 can shed light on the mechanisms of olfactory signaling and may lead to applications in designing new fragrance compounds or developing novel therapeutic strategies for olfactory dysfunction. Moreover, the exploration of its genetic variations might provide insights into human olfactory diversity and preferences. As the field of sensory biology expands, the study of GPCRs like OR8G1 becomes increasingly relevant in both basic research and applied sciences, highlighting the necessity to elucidate the molecular pathways governing sensory perception.
