Analytical Data
-
Gene name
OR8D4
- Application
-
Alternative Names
OR8D4; Olfactory receptor 8D4; Olfactory receptor OR11-275
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGM9
-
Expression Region
1-314 aa
-
AA Sequence
MGVKNHSTVTEFLLSGLTEQAELQLPLFCLFLGIYTVTVVGNLSMISIIRLNRQLHTPMY YFLSSLSFLDFCYSSVITPKMLSGFLCRDRSISYSGCMIQLFFFCVCVISECYMLAAMAC DRYVAICSPLLYRVIMSPRVCSLLVAAVFSVGFTDAVIHGGCILRLSFCGSNIIKHYFCD IVPLIKLSCSSTYIDELLIFVIGGFNMVATSLTIIISYAFILTSILRIHSKKGRCKAFST CSSHLTAVLMFYGSLMSMYLKPASSSSLTQEKVSSVFYTTVILMLNPLIYSLRNNEVRNA LMKLLRRKISLSPG
-
Molecular Weight
35.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR8D4 is a member of the olfactory receptor family, specifically classified as a G protein-coupled receptor (GPCR), which plays a crucial role in the sensory perception of odors. While olfactory receptors are predominantly studied for their function in the nose, emerging research highlights their presence in various other tissues and their potential roles beyond sensory perception, such as in immune response and neurobiology. The reconstitution of OR8D4 as a recombinant protein allows researchers to investigate its structural and functional characteristics, thus advancing our understanding of its signaling mechanisms and ligand interactions. Studies have shown that OR8D4 can respond to specific ligands, and its activation might be involved in mediating physiological processes. Moreover, due to its expression in non-olfactory tissues, understanding its function could reveal novel insights into various pathophysiological conditions. Thus, the research on the OR8D4 recombinant protein is not only significant for elucidating olfactory mechanisms but also for exploring its broader implications in health and disease.
