Analytical Data
-
Gene name
Mel
- Application
-
Alternative Names
Mel;MEL;RAB8;Ras-related Protein Rab-8A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61006
-
Expression Region
1-207aa
-
AA Sequence
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
-
Molecular Weight
23.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Mel recombinant protein research focuses on the application and understanding of the Mel protein, a important component in various biological processes. Initially identified as a significant factor in cellular signaling pathways, the Mel protein has drawn attention due to its role in regulating gene expression, cell differentiation, and apoptosis. Researchers have been particularly interested in its potential therapeutic applications, especially in the context of diseases such as cancer and genetic disorders. The ability to produce recombinant Mel protein through genetic engineering techniques has enabled scientists to conduct detailed studies on its structure, function, and interactions with other biomolecules. This has facilitated the exploration of its role in metabolic regulation and immune response. Furthermore, the development of Mel protein-based assays and therapeutic agents holds promise for innovative treatment strategies. Overall, the ongoing research into Mel recombinant protein not only enhances our understanding of fundamental biological mechanisms but also paves the way for novel medical advancements.











