Analytical Data
-
Gene name
THAP7
- Application
-
Alternative Names
THAP7；THAP domain-containing Protein 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BT49
-
Expression Region
1-309aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMPRHCSAAGCCTRDTRETRNRGISFHR LPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHFEEDCFELVG ISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPAEVSRLRRCRKRC SEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSD LLGPLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQ NEHSYQVGSALLWKRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQ ERAREKRAQADARQTLKEHVQDFAMQLSSSMA
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
THAP7, a member of the THAP (for "THAP domain containing") protein family, has garnered attention in recent years due to its potential roles in various biological processes and disease mechanisms. The THAP domain is characterized by its ability to bind DNA and regulate transcription, suggesting that THAP7 may be involved in gene expression regulation. Research has indicated that THAP7 might play a critical role in cell differentiation and proliferation, making it a candidate for understanding developmental biology and cancer. Initial studies have shown its involvement in the regulation of neuronal and muscle cell development, linking it to neurogenesis and myogenesis. Additionally, aberrant expression of THAP7 has been associated with certain cancers, highlighting its potential as a biomarker or therapeutic target. The production of recombinant THAP7 protein enables in-depth exploration of its biochemical properties, interaction with molecular partners, and functional assays to elucidate its mechanisms of action. Investigating THAP7 through recombinant technologies could provide insights into its role in cellular processes and its implications in health and disease, paving the way for novel therapeutic strategies. Understanding its structure-function relationships will be crucial for developing targeted interventions in diseases associated with its dysregulation. Overall, the research on THAP7 and its recombinant protein forms represents a promising avenue for further elucidating the complexities of gene regulation and its impact on cellular dynamics.
