Analytical Data
-
Gene name
OR8B3
- Application
-
Alternative Names
OR8B3; Olfactory receptor 8B3; Olfactory receptor OR11-311
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGG8
-
Expression Region
1-313 aa
-
AA Sequence
MLARNNSLVTEFILAGLTDHPEFQQPLFFLFLVVYIVTMVGNLGLIILFGLNSHLHTPMY YFLFNLSFIDLCYSSVFTPKMLMNFVSKKNIISYVGCMTQLFFFLFFVISECYMLTSMAY DRYVAICNPLLYKVTMSHQVCSMLTFAAYIMGLAGATAHTGCMLRLTFCSANIINHYLCD ILPLLQLSCTSTYVNEVVVLIVVGINIMVPSCTILISYVFIVTSILHIKSTQGRSKAFST CSSHVIALSLFFGSAAFMYIKYSSGSMEQGKVSSVFYTNVVPMLNPLIYSLRNKDVKVAL RKALIKIQRRNIF
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR8B3, a member of the olfactory receptor family, has garnered significant attention in the field of sensory biology and neuroscience due to its role in the detection of odorants. This receptor is primarily expressed in the olfactory epithelium and is involved in the recognition of specific volatile compounds, contributing to the complex phenomena of odor perception. Recent advances in molecular biology and proteomics have made it possible to produce and study recombinant OR8B3 proteins, allowing researchers to explore their structure-function relationships and activation mechanisms in greater detail. Understanding OR8B3's signaling pathways and its interactions with various ligands may provide insights into the molecular basis of olfactory processing and the potential implications for odor-related behaviors. Furthermore, investigations into OR8B3 could have broader applications in developing strategies for modulating olfactory functions, addressing disorders related to smell, and even designing novel scents for industrial applications. The reconstitution of OR8B3 in heterologous systems has opened new avenues for drug discovery and bioengineering, highlighting the receptor's significance in both fundamental research and practical applications. As such, the study of OR8B3 not only enhances our understanding of the olfactory system but also paves the way for innovative approaches in pharmacology and sensory technologies.











