Analytical Data
-
Gene name
OR8B12
- Application
-
Alternative Names
OR8B12; Olfactory receptor 8B12; Olfactory receptor OR11-317
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGG6
-
Expression Region
1-310 aa
-
AA Sequence
MAAKNSSVTEFILEGLTHQPGLRIPLFFLFLGFYTVTVVGNLGLITLIGLNSHLHTPMYF FLFNLSLIDFCFSTTITPKMLMSFVSRKNIISFTGCMTQLFFFCFFVVSESFILSAMAYD RYVAICNPLLYTVTMSCQVCLLLLLGAYGMGFAGAMAHTGSIMNLTFCADNLVNHFMCDI LPLLELSCNSSYMNELVVFIVVAVDVGMPIVTVFISYALILSSILHNSSTEGRSKAFSTC SSHIIVVSLFFGSGAFMYLKPLSILPLEQGKVSSLFYTIIVPVLNPLIYSLRNKDVKVAL RRTLGRKIFS
-
Molecular Weight
34.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR8B12 is a member of the olfactory receptor gene family, which plays a crucial role in the perception of odorants. Olfactory receptors, including OR8B12, are G protein-coupled receptors located in the olfactory epithelium and are responsible for the detection of volatile chemical molecules in the environment. Research on OR8B12 is particularly significant given its potential implications in understanding the mechanisms of smell and its role in the overall sensory experience of organisms. This receptor is of interest not only for its physiological function in olfaction but also for its potential involvement in various physiological processes and disease states. The recombinant OR8B12 protein can be produced for in vitro studies, allowing researchers to investigate its ligand-binding properties, signal transduction mechanisms, and potential interactions with other cellular signaling pathways. Furthermore, by elucidating the structure and function of OR8B12, scientists can gain insights into the evolution of olfactory receptors and their diverse roles in different species. Understanding the molecular basis of OR8B12 and its interactions could provide valuable information for developing therapeutic strategies for olfactory dysfunction or sensory processing disorders, thereby highlighting its significance in both basic and applied sciences.
