Analytical Data
-
Gene name
TGIF2LX
- Application
-
Alternative Names
TGIF2LX;TGIFLX;Homeobox Protein TGIF2LX
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IUE1
-
Expression Region
1-241aa
-
AA Sequence
MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP
-
Molecular Weight
42.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TGIF2LX, a member of the TGIF family of transcription factors, has garnered attention due to its role in various biological processes, including embryonic development and cellular signaling pathways. The TGIF family is known for its involvement in the regulation of gene expression, and TGIF2LX, in particular, is implicated in the modulation of genes related to growth, differentiation, and immune responses. Previous studies have established that TGIF proteins can interact with other transcription factors and corepressors, influencing transcriptional outcomes. Additionally, alterations in TGIF2LX expression have been linked to several diseases, such as cancer and developmental disorders. Understanding the functionality and regulation of TGIF2LX through the production and characterization of recombinant proteins can provide valuable insights into its role in cellular mechanisms and disease pathology. This research not only aims to elucidate the molecular interactions of TGIF2LX but also seeks to explore its potential as a therapeutic target or biomarker. Overall, the study of TGIF2LX offers a promising avenue for understanding fundamental biological processes and developing innovative approaches for disease intervention.











