Analytical Data
-
Gene name
ANKRD45
- Application
-
Alternative Names
ANKRD45; ankyrin repeat domain 45; Ankyrin repeat domain containing Protein 45
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TZF3
-
Expression Region
1-266aa
-
AA Sequence
MESEGPPESESSEFFSQQEEENEEEEAQEPEETGPKNPLLQPALTGDVEGLQKIFEDPENPHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAWGRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN
-
Molecular Weight
56.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANKRD45, a member of the ankyrin repeat-containing protein family, has garnered considerable attention in recent years due to its potential roles in various cellular processes and its involvement in human diseases. These proteins are characterized by the presence of multiple ankyrin repeats, which typically mediate protein-protein interactions, thus playing critical roles in cellular signaling, cytoskeletal organization, and gene regulation. Recent studies have suggested that ANKRD45 may be implicated in pathological conditions, including cancer and neurodegenerative diseases, highlighting its significance as a therapeutic target. To better understand its biological functions and mechanisms of action, researchers have turned to recombinant protein technology, enabling the production of purified ANKRD45 for in-depth biochemical and structural studies. This research aims to elucidate the protein's interaction partners, post-translational modifications, and its role in disease pathology, ultimately paving the way for the development of targeted therapies. As the field progresses, characterizing ANKRD45 through recombinant expression systems may provide valuable insights into its functions and contributions to health and disease, making it a promising candidate for future therapeutic interventions.
