Analytical Data
-
Gene name
FOLT
- Application
-
Alternative Names
FOLT；FLOT1；RFC1；Reduced folate transporter
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P41440
-
Expression Region
420-591aa
-
AA Sequence
DVRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ
-
Molecular Weight
25.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FOLT, or Folatebinding Protein, is gaining attention in biomedical research due to its critical role in folate metabolism and cellular uptake, which are essential for DNA synthesis and repair, cell division, and overall cellular function. This protein is particularly important in the context of cancer and developmental disorders, where alterations in folate transport can lead to significant health issues. Researchers are exploring FOLT as a potential therapeutic target, as its overexpression in certain cancer types is linked to tumor growth and progression. Additionally, FOLT's ability to bind folate has prompted investigations into its use as a drug delivery system, leveraging the protein's natural affinity to transport therapeutic agents selectively into cancer cells. Understanding the structure and function of FOLT, as well as its interactions with folate and other molecules, is crucial for the development of innovative treatment approaches. Recent advancements in recombinant protein technology have enabled the production of FOLT in significant quantities, facilitating studies on its biophysical properties and biological functions. The insights gained from these studies may lead to novel interventions aimed at using FOLT as a biomarker for early cancer detection and as a tool for targeted therapy, thereby contributing to the evolving landscape of precision medicine. Overall, the research surrounding FOLT underscores the importance of this protein in health and disease, highlighting its potential as a pivotal player in future therapeutic strategies.
