Analytical Data
-
Gene name
OR6V1
- Application
-
Alternative Names
OR6V1; Olfactory receptor 6V1; Olfactory receptor OR7-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N148
-
Expression Region
1-313 aa
-
AA Sequence
MANLSQPSEFVLLGFSSFGELQALLYGPFLMLYLLAFMGNTIIIVMVIADTHLHTPMYFF LGNFSLLEILVTMTAVPRMLSDLLVPHKVITFTGCMVQFYFHFSLGSTSFLILTDMALDR FVAICHPLRYGTLMSRAMCVQLAGAAWAAPFLAMVPTVLSRAHLDYCHGDVINHFFCDNE PLLQLSCSDTRLLEFWDFLMALTFVLSSFLVTLISYGYIVTTVLRIPSASSCQKAFSTCG SHLTLVFIGYSSTIFLYVRPGKAHSVQVRKVVALVTSVLTPFLNPFILTFCNQTVKTVLQ GQMQRLKGLCKAQ
-
Molecular Weight
34.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR6V1 is a member of the olfactory receptor (OR) family, which plays a crucial role in the detection of various odorant molecules and is vital for the sense of smell in humans and other animals. Research into OR6V1 focuses on understanding its structural and functional characteristics, particularly because it is associated with the perception of certain odorants, including specific food aromas and pheromones. The recombination of OR6V1 into a functional protein allows scientists to study its interactions with potential ligands and elucidate the underlying mechanisms of olfactory signaling pathways. Given the complex nature of olfactory receptors, which are G-protein-coupled receptors (GPCRs), recombinant OR6V1 protein can be utilized in various assays to investigate receptor dynamics, expression patterns, and their roles in olfactory transduction. This research is significant not only for advancing our knowledge of sensory biology but also for potential applications in flavor and fragrance industries, as well as in developing therapeutic strategies for olfactory dysfunctions. Understanding the functional properties of OR6V1 may also provide insights into evolutionary adaptations and the genetic basis of olfactory perception across different species. Overall, the study of OR6V1 recombinant protein contributes to the broader field of sensory biology, emphasizing the importance of olfactory receptors in sensory communication and the intricate relationship between environmental stimuli and organismal behavior.
