Analytical Data
-
Gene name
TFAM
- Application
-
Alternative Names
TFAM；TCF6；Transcription factor A. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00059
-
Expression Region
43-246aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSSVLASCPKKPVSSYLRFSKEQLPIFKAQ NPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQL TPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQ EAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQ MIEVGRKDLLRRTIKKQRKYGAEEC
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Transcription factor A mitochondrial (TFAM) is a crucial protein that plays a significant role in the maintenance and regulation of mitochondrial DNA (mtDNA). Given its essential functions in mitochondrial biogenesis, TFAM is vital for energy metabolism, cellular signaling, and apoptosis. The study of TFAM has gained prominence due to its involvement in various pathological conditions, including neurodegenerative diseases, metabolic disorders, and aging, where mitochondrial dysfunction is evident. Aberrant expression or mutations in TFAM have been associated with impaired mitochondrial function, highlighting its importance in cellular health and disease. Researchers have increasingly focused on TFAM as a potential therapeutic target, investigating its role in promoting mtDNA replication and repair, as well as its influence on mitochondrial-related pathways. Additionally, TFAM's capability to interact with other proteins and regulate gene expression enhances its significance in mitochondrial research. Understanding TFAM's structure and function provides insights into its mechanistic roles and paves the way for developing innovative strategies for treating conditions linked to mitochondrial dysfunction. Overall, the comprehensive study of TFAM and its recombinant forms continues to be a promising avenue for advancing mitochondrial biology and addressing numerous health challenges associated with mitochondrial impairment.
