Analytical Data
-
Gene name
OR6C75
- Application
-
Alternative Names
OR6C75; Olfactory receptor 6C75
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NL08
-
Expression Region
1-312 aa
-
AA Sequence
MRNSTAVTDFILLGLTSDPQWQVVLFIFLLVTYMLSVTGNLIIITLTLSDPHLQTPMYFF LRNFSFLEISFTSVCIPRFLVTVVTGNRTISYNGCVAQLFFFIFLGVTEFYLLAAMSYDR CMAICKPLHYTIIMSTRVCTLLVFSSWLAGFLIIFPPVMLLLQLDFCASNVIDHFICDSS PMLQLSCTNTHFLELMAFFLAVVTLMVTLTLVILSYTNIIRTILKIPSMSQRKKAFSTCS SHMIVVSISYSSCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFK SMVQKMIFSLNK
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR6C75 is a member of the olfactory receptor (OR) gene family, which plays a crucial role in the sensory perception of odors. Olfactory receptors are G protein-coupled receptors (GPCRs) located in the nasal epithelium, where they detect volatile odorant molecules and initiate signaling pathways that culminate in the perception of smell. The OR gene family is highly diverse, with hundreds of genes contributing to the complexity of olfactory sensing. Research on OR6C75 is particularly relevant due to its potential involvement in specific odorant recognition and its implications for understanding olfactory mechanisms. Recombination and expression of OR6C75 as a recombinant protein facilitate the study of its functional properties, ligand binding affinities, and downstream signaling pathways. The use of recombinant technology enables researchers to produce large quantities of the protein for detailed biochemical analyses and to explore its role in olfactory transduction. Understanding OR6C75 and similar receptors may not only enhance our knowledge of olfactory biology but also provide insights into evolutionary adaptations of sensory systems, as well as potential applications in fields such as flavor and fragrance industries, where manipulating olfactory responses can have significant commercial value. Overall, OR6C75 serves as a model for exploring the molecular mechanisms underlying smell perception and the intricate interactions between receptors and odorants in the olfactory system.











