Cat: PAX2000-10002

Recombinant Human OR6C75 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR6C75

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR6C75; Olfactory receptor 6C75

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A6NL08

  • Expression Region

    1-312 aa

  • AA Sequence

    MRNSTAVTDFILLGLTSDPQWQVVLFIFLLVTYMLSVTGNLIIITLTLSDPHLQTPMYFF LRNFSFLEISFTSVCIPRFLVTVVTGNRTISYNGCVAQLFFFIFLGVTEFYLLAAMSYDR CMAICKPLHYTIIMSTRVCTLLVFSSWLAGFLIIFPPVMLLLQLDFCASNVIDHFICDSS PMLQLSCTNTHFLELMAFFLAVVTLMVTLTLVILSYTNIIRTILKIPSMSQRKKAFSTCS SHMIVVSISYSSCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFK SMVQKMIFSLNK

  • Molecular Weight

    35.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR6C75 is a member of the olfactory receptor (OR) gene family, which plays a crucial role in the sensory perception of odors. Olfactory receptors are G protein-coupled receptors (GPCRs) located in the nasal epithelium, where they detect volatile odorant molecules and initiate signaling pathways that culminate in the perception of smell. The OR gene family is highly diverse, with hundreds of genes contributing to the complexity of olfactory sensing. Research on OR6C75 is particularly relevant due to its potential involvement in specific odorant recognition and its implications for understanding olfactory mechanisms. Recombination and expression of OR6C75 as a recombinant protein facilitate the study of its functional properties, ligand binding affinities, and downstream signaling pathways. The use of recombinant technology enables researchers to produce large quantities of the protein for detailed biochemical analyses and to explore its role in olfactory transduction. Understanding OR6C75 and similar receptors may not only enhance our knowledge of olfactory biology but also provide insights into evolutionary adaptations of sensory systems, as well as potential applications in fields such as flavor and fragrance industries, where manipulating olfactory responses can have significant commercial value. Overall, OR6C75 serves as a model for exploring the molecular mechanisms underlying smell perception and the intricate interactions between receptors and odorants in the olfactory system.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US