Cat: PA1000-3163

Recombinant Human TDP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TDP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TDP1;DP1;Transcription factor Dp-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NUW8

  • Expression Region

    1-608aa

  • AA Sequence

    MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSE AQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEM PQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGE GQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSA QFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISL CQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSP LYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSET NVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSS VGSLGADESKWLCSEFKESMLTLGKESKTPGKSSVPLYLIYPSVENVRTS LEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNAMPHIKTYMRP SPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGL DSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDT HGNMWVPS

  • Molecular Weight

    93 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TDP1 (Tyrosyl-DNA phosphodiesterase 1) is an important enzyme involved in the repair of DNA damage caused by certain types of lesions, particularly those resulting from topoisomerase I activity. Topoisomerase I generates temporary single-strand breaks in DNA to alleviate torsional strain during replication and transcription, but if these breaks are not properly resolved, they can lead to cytotoxic effects and genomic instability. TDP1 plays a crucial role in removing the covalent linkage between topoisomerase I and DNA, thereby facilitating the repair process. Research into TDP1 has gained attention due to its implications in cancer therapy, as inhibiting TDP1 can enhance the effectiveness of topoisomerase inhibitors commonly used in chemotherapy. Additionally, mutations in the TDP1 gene have been associated with a rare neurodegenerative disorder known as SCAN1, which further underscores the enzyme's significance in maintaining genomic integrity. Understanding the structure and function of recombinant TDP1 is essential for developing targeted therapies and improving existing treatment strategies for cancers driven by topoisomerase dysregulation. Experimental studies involving the expression and purification of recombinant TDP1 have provided insights into its enzymatic mechanism and substrate specificity, laying the groundwork for novel anticancer strategies and the potential development of TDP1 inhibitors that can be used to sensitize tumors to conventional therapies. These investigations are vital for advancing our knowledge of DNA repair processes and their roles in disease, particularly in the context of cancer biology and therapeutic resistance.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US