Analytical Data
-
Gene name
OR5K1
- Application
-
Alternative Names
OR5K1; Olfactory receptor 5K1; HTPCRX10; Olfactory receptor OR3-8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHB7
-
Expression Region
1-308 aa
-
AA Sequence
MAEENHTMKNEFILTGFTDHPELKTLLFVVFFAIYLITVVGNISLVALIFTHRRLHTPMY IFLGNLALVDSCCACAITPKMLENFFSENKRISLYECAVQFYFLCTVETADCFLLAAMAY DRYVAICNPLQYHIMMSKKLCIQMTTGAFIAGNLHSMIHVGLVFRLVFCGSNHINHFYCD ILPLYRLSCVDPYINELVLFIFSGSVQVFTIGSVLISYLYILLTIFKMKSKEGRAKAFST CASHFLSVSLFYGSLFFMYVRPNLLEEGDKDIPAAILFTIVVPLLNPFIYSLRNREVISV LRKILMKK
-
Molecular Weight
35.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR5K1, a member of the olfactory receptor gene family, has garnered interest due to its potential roles in various physiological processes and its implications in health and disease. Olfactory receptors are pivotal for the sense of smell, but recent studies have suggested that they may also be involved in non-olfactory functions, including immune response and cellular signaling. Research on OR5K1 specifically aims to elucidate its structure, function, and physiological relevance in humans. Understanding OR5K1's signaling pathways could provide insights into its involvement in disorders such as chronic inflammatory diseases and neurological conditions. Moreover, the recombinant production of OR5K1 has facilitated the investigation of its biochemical properties and interactions with ligands. These studies are crucial for developing therapeutic strategies targeting OR5K1 and similar receptors. As the field of olfactory receptor research expands, OR5K1 stands out as a target for further exploration in both basic and applied sciences, potentially leading to breakthroughs in treating complex health issues related to this receptor family.
