Analytical Data
-
Gene name
OR5C1
- Application
-
Alternative Names
OR5C1; OR5C2P; Olfactory receptor 5C1; Olfactory receptor 5C2; Olfactory receptor 9-F; OR9-F
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGR4
-
Expression Region
1-320 aa
-
AA Sequence
MNSENLTRAAVAPAEFVLLGITNRWDLRVALFLTCLPVYLVSLLGNMGMALLIRMDARLH TPMYFFLANLSLLDACYSSAIGPKMLVDLLLPRATIPYTACALQMFVFAGLADTECCLLA AMAYDRYVAIRNPLLYTTAMSQRLCLALLGASGLGGAVSAFVHTTLTFRLSFCRSRKINS FFCDIPPLLAISCSDTSLNELLLFAICGFIQTATVLAITVSYGFIAGAVIHMRSVEGSRR AASTGGSHLTAVAMMYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKE VKEALRQTWSRFHCPGQGSQ
-
Molecular Weight
34.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR5C1 gene encodes a protein that belongs to the olfactory receptor family, playing a pivotal role in the sensory perception of smell. As a G protein-coupled receptor (GPCR), OR5C1 is involved in transducing external odorant signals into neuronal responses, thereby influencing various biological processes related to olfaction. Recent research has highlighted the significance of olfactory receptors beyond the traditional sensory roles, suggesting involvement in various physiological functions, including immune responses and even potential roles in cancer biology. Studies have shown that OR5C1 is expressed in various tissues, which raises intriguing questions about its non-sensory functions. Furthermore, the distinct ligand specificity of OR5C1 presents opportunities for exploring its applications in fragrance and flavor industries through the development of tailored compounds. The recombinant expression of OR5C1 is essential for understanding its structure-function relationships, facilitating the identification of suitable ligands and potential therapeutic targets. The study of OR5C1 and its interactions is crucial for elucidating the underlying mechanisms of olfactory transmission and exploring its broader implications in health and disease. Understanding the dynamics of OR5C1 could pave the way for innovative applications in biotechnology and medicine, positioning it as a significant target for further research in receptor biology.
