Analytical Data
-
Gene name
ANAPC1
- Application
-
Alternative Names
ANAPC 1; Anapc1; Anaphase promoting complex subunit 1; anaphase-promoting complex 1 (meiotic checkpoint regulator); Anaphase-promoting complex subunit 1; Apc 1; APC1; APC1_HUMAN; Cyclosome subunit 1; MCPR; Meiotic checkpoint regulator; Mitotic checkpoint regulator; Protein Tsg 24; Protein Tsg24; Testis-specific gene 24 Protein; TSG 24; TSG24
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H1A4
-
Expression Region
1841-1944aa
-
AA Sequence
NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM
-
Molecular Weight
37.18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANAPC1, the largest subunit of the anaphase-promoting complex/cyclosome (APC/C), plays a critical role in cell cycle regulation, particularly in the transition from metaphase to anaphase during mitosis. The APC/C is an E3 ubiquitin ligase that targets specific proteins for ubiquitination and subsequent degradation by the proteasome, thereby ensuring the proper timing of cell cycle progression. Aberrations in the function or regulation of ANAPC1 have been implicated in various cancers, making it a significant focus of research in cancer biology. The study of recombinant ANAPC1 protein offers valuable insights into its structure, functional mechanisms, and interactions with other cell cycle regulators. Understanding how ANAPC1 modulates the ubiquitination process is crucial for elucidating its role in cellular homeostasis and tumorigenesis. Additionally, recombinant ANAPC1 can be utilized in biochemical assays to identify potential inhibitors or modulators, paving the way for novel therapeutic approaches targeting cell cycle dysregulation in cancer. Therefore, the exploration of ANAPC1 and its associated pathways not only broadens our understanding of cell cycle regulation but also holds promise for the development of innovative strategies to combat cancer.
