Analytical Data
-
Gene name
TAX1BP3
- Application
-
Alternative Names
TAX1BP3；TIP1；Tax1-binding Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14907
-
Expression Region
1-124aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHKLRQGENLILG FSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQV NGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAX1BP3 (Tax1-binding protein 3) is a multifunctional protein that plays a crucial role in various cellular processes, including immune response regulation, apoptosis, and cellular stress responses. Its involvement in the pathogenesis of several diseases, particularly cancer and viral infections, has made it a significant focus of research. TAX1BP3 has been implicated in the modulation of NF-κB signaling pathways, which are essential for inflammation and immune responses. Additionally, its interaction with viral proteins, such as the human T-cell leukemia virus type 1 (HTLV-1) TAX protein, highlights its importance in virus-host interactions and the potential for targeted therapeutic interventions. Given its diverse functions and relevance in disease mechanisms, the study of TAX1BP3 recombinant protein has garnered interest in the scientific community. Understanding its structure, interactions, and regulatory mechanisms can provide insights into novel therapeutic strategies and enhance our understanding of its role in both health and disease. Recent advancements in recombinant protein technology have facilitated the production and purification of TAX1BP3, enabling detailed biochemical characterization and functional analyses, which are essential for unraveling its biological significance and therapeutic potential.
