Analytical Data
-
Gene name
OR5BU1
- Application
-
Alternative Names
OR14I1; OR5BU1; OR5BU1P; Olfactory receptor 14I1; Olfactory receptor 5BU1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6ND48
-
Expression Region
1-311 aa
-
AA Sequence
MDNLTKVTEFLLMEFSGIWELQVLHAGLFLLIYLAVLVGNLLIIAVITLDQHLHTPMYFF LKNLSVLDLCYISVTVPKSIRNSLTRRSSISYLGCVAQVYFFSAFASAELAFLTVMSYDR YVAICHPLQYRAVMTSGGCYQMAVTTWLSCFSYAAVHTGNMFREHVCRSSVIHQFFRDIP HVLALVSCEVFFVEFLTLALSSCLVLGCFILMMISYFQIFSTVLRIPSGQSRAKAFSTCS PQLIVIMLFLTTGLFAALGPIAKALSIQDLVIALTYTVLPPFLNPIIYSLRNKEIKTAMW RLFVKIYFLQK
-
Molecular Weight
35.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR5BU1 protein is a member of the olfactory receptor family, which plays a crucial role in the sense of smell. Research into OR5BU1 has gained attention due to its potential implications in olfactory signaling pathways and sensory processes. Olfactory receptors are G-protein-coupled receptors that are responsible for detecting odorant molecules and initiating neuronal responses that contribute to the perception of smell. Variations in the expression or function of these receptors can influence olfactory sensitivity and have been linked to various neurological conditions and sensory disorders. Furthermore, understanding the structure and function of OR5BU1 may provide insights into the mechanisms of odorant recognition and receptor activation. This has broader implications in the fields of neurobiology, pharmacology, and even in designing artificial olfactory systems. The study of OR5BU1 recombinant proteins can facilitate high-throughput screening for potential therapeutic compounds or aid in the development of biosensors for odor detection, marking its significance in both academic research and practical applications. Overall, the exploration of OR5BU1 not only enhances our understanding of olfactory biology but also opens new avenues in biotechnology and medicine.











