Analytical Data
-
Gene name
OR52N5
- Application
-
Alternative Names
OR52N5; Olfactory receptor 52N5; Olfactory receptor OR11-62
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH56
-
Expression Region
1-324 aa
-
AA Sequence
MPLFNSLCWFPTIHVTPPSFILNGIPGLERVHVWISLPLCTMYIIFLVGNLGLVYLIYYE ESLHHPMYFFFGHALSLIDLLTCTTTLPNALCIFWFSLKEINFNACLAQMFFVHGFTGVE SGVLMLMALDRYVAICYPLRYATTLTNPIIAKAELATFLRGVLLMIPFPFLVKRLPFCQS NIISHTYCDHMSVVKLSCASIKVNVIYGLMVALLIGVFDICCISLSYTLILKAAISLSSS DARQKAFSTCTAHISAIIITYVPAFFTFFAHRFGGHTIPPSLHIIVANLYLLLPPTLNPI VYGVKTKQIRKSVIKFFQGDKGAG
-
Molecular Weight
36.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR52N5, a member of the olfactory receptor gene family, has garnered significant attention in recent research due to its potential roles in human olfaction and its association with various physiological processes. Olfactory receptors (ORs) are G protein-coupled receptors that play a critical role in the detection of odorants and are predominantly expressed in the olfactory epithelium. However, recent studies suggest that ORs, including OR52N5, may also be involved in non-olfactory functions, influencing various biological pathways. Understanding the molecular mechanisms and functional roles of OR52N5 is crucial, as it may provide insights into the neural circuitry of odor perception and its implications in behaviors and disorders related to olfactory processing. Additionally, given the growing evidence of the involvement of ORs in cancer biology and other pathologies, investigating OR52N5 could have therapeutic implications. The recombinant expression of OR52N5 allows for detailed studies on its ligand specificity, signaling pathways, and potential interactions with other proteins, which could shed light on the broader functional diversity of olfactory receptors. Thus, the exploration of OR52N5 not only deepens our understanding of olfactory mechanisms but also opens new avenues for research into its relevance in health and disease.
