Analytical Data
-
Gene name
OR52A1
- Application
-
Alternative Names
OR52A1; Olfactory receptor 52A1; HPFH1OR; Odorant receptor HOR3'beta4; Olfactory receptor OR11-319
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UKL2
-
Expression Region
1-312 aa
-
AA Sequence
MSISNITVYMPSVLTLVGIPGLESVQCWIGIPFCAIYLIAMIGNSLLLSIIKSERSLHEP LYIFLGMLGATDIALASSIMPKMLGIFWFNVPEIYFDSCLLQMWFIHTLQGIESGILVAM ALDRYVAICYPLRHANIFTHQLVIQIGTMVVLRAAILVAPCLVLIKCRFQFYHTTVISHS YCEHMAIVKLAAANVQVNKIYGLFVAFTVAGFDLTFITLSYIQIFITVFRLPQKEARFKA FNTCIAHICVFLQFYLLAFFSFFTHRFGSHISPYIHILFSSIYLLVPPFLNPLVYGAKTT QIRIHVVKMFCS
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR52A1 is a member of the olfactory receptor family, which plays a vital role in the sensory perception of odorants. Recent research has highlighted the significance of these receptors beyond traditional olfaction, suggesting that they are involved in various physiological processes, including immune responses and tumor progression. OR52A1, specifically, has garnered attention due to its expression in various tissues, including the respiratory system and certain cancer cells. Studies indicate that OR52A1 may be implicated in the modulation of inflammatory responses and could act as a potential biomarker for certain diseases. The recombinant expression of OR52A1 protein allows for detailed biomechanical studies, facilitating the investigation of its ligand-binding properties, signaling pathways, and potential therapeutic applications. Understanding the structure and function of OR52A1 through recombinant technologies can pave the way for novel approaches in targeting diseases associated with dysfunctional olfactory signaling and could enhance our comprehension of the broader roles that olfactory receptors play in human health. As research evolves, elucidating the mechanisms of action and the functional implications of OR52A1 could contribute significantly to the development of innovative strategies for disease intervention and management.
