Analytical Data
-
Gene name
SYT1
- Application
-
Alternative Names
SYT1；SVP65；Synaptotagmin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21579
-
Expression Region
136-382aa
-
AA Sequence
MEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKV FLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDR FSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYV PTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKN TLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNLE HHHHHH
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SYT1 (Synaptotagmin 1) is a calcium-sensor protein primarily known for its crucial role in the process of synaptic vesicle release at neurons. This protein is a member of the synaptotagmin family, which regulates neurotransmitter release by responding to changes in intracellular calcium levels. Its functions are pivotal for synaptic transmission, as it facilitates the fusion of synaptic vesicles with the presynaptic membrane in response to calcium influx, thereby triggering neurotransmitter release. Research on SYT1 has gained traction due to its implications in various neurological disorders and its potential as a therapeutic target. Understanding the structural and functional dynamics of SYT1 can elucidate its role in synaptic plasticity and neurotransmission, as well as provide insights into the mechanisms underlying synaptic dysfunction in diseases such as Alzheimer's and Parkinson's. Recombinant SYT1 protein studies have become essential in characterizing its calcium-binding properties and interaction with other synaptic proteins, thus offering a deeper understanding of its biological functions and the molecular mechanisms that govern synaptic signaling. As research continues to unveil the complexities of synaptic mechanisms, SYT1 stands out as a key player, warranting extensive investigation into its role in health and disease. The development of recombinant SYT1 proteins is thus a critical step toward unveiling new therapeutic strategies aimed at modulating synaptic function and addressing neurological conditions.
