Analytical Data
-
Gene name
OR51L1
- Application
-
Alternative Names
OR51L1; Olfactory receptor 51L1; Olfactory receptor OR11-31
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGJ5
-
Expression Region
1-315 aa
-
AA Sequence
MGDWNNSDAVEPIFILRGFPGLEYVHSWLSILFCLAYLVAFMGNVTILSVIWIESSLHQP MYYFISILAVNDLGMSLSTLPTMLAVLWLDAPEIQASACYAQLFFIHTFTFLESSVLLAM AFDRFVAICHPLHYPTILTNSVIGKIGLACLLRSLGVVLPTPLLLRHYHYCHGNALSHAF CLHQDVLRLSCTDARTNSIYGLCVVIATLGVDSIFILLSYVLILNTVLDIASREEQLKAL NTCVSHICVVLIFFVPVIGVSMVHRFGKHLSPIVHILMADIYLLLPPVLNPIVYSVRTKQ IRLGILHKFVLRRRF
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR51L1 is a member of the olfactory receptor gene family, primarily known for its role in the detection of odorant molecules. Recent studies have highlighted its potential involvement in non-sensory functions, including roles in various physiological processes and diseases. Research into OR51L1 has intensified due to its intriguing expression patterns in non-olfactory tissues, such as the prostate and certain cancer cell lines. This has led scientists to investigate its potential as a therapeutic target and biomarker in prostate cancer and other malignancies. Furthermore, the understanding of OR51L1's signaling mechanisms and its interactions with other proteins could unveil novel pathways involved in tumor progression and metastasis. Recombining OR51L1 allows for the detailed analysis of its structure-function relationship and its biochemical properties, which is essential for developing inhibitors or modulators that could have clinical applications. The exploration of OR51L1 reconstituted proteins provides insights into how this receptor could be manipulated for therapeutic benefits, making it a focal point in both cancer research and drug development. As such, the study of OR51L1 and its recombinant forms is positioned at the intersection of molecular biology, pharmacology, and clinical research, offering promising avenues for advancements in understanding and treating diseases linked to this receptor.
