Analytical Data
-
Gene name
OR51I2
- Application
-
Alternative Names
OR51I2; Olfactory receptor 51I2; Odorant receptor HOR5'beta12; Olfactory receptor OR11-38
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H344
-
Expression Region
1-312 aa
-
AA Sequence
MGLFNVTHPAFFLLTGIPGLESSHSWLSGPLCVMYAVALGGNTVILQAVRVEPSLHEPMY YFLSMLSFSDVAISMATLPTVLRTFCLNARNITFDACLIQMFLIHFFSMMESGILLAMSF DRYVAICDPLRYATVLTTEVIAAMGLGAAARSFITLFPLPFLIKRLPICRSNVLSHSYCL HPDMMRLACADISINSIYGLFVLVSTFGMDLFFIFLSYVLILRSVMATASREERLKALNT CVSHILAVLAFYVPMIGVSTVHRFGKHVPCYIHVLMSNVYLFVPPVLNPLIYSAKTKEIR RAIFRMFHHIKI
-
Molecular Weight
35.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR51I2, a member of the olfactory receptor gene family, has garnered significant interest in recent years due to its unconventional expression patterns and potential roles beyond traditional odor detection. Initially characterized for its involvement in the olfactory system, OR51I2 has been implicated in various physiological and pathological processes, including tumor progression and modulation of immune responses. Studies have shown that this receptor is not only present in the olfactory epithelium but is also expressed in several non-olfactory tissues, raising questions about its functional significance in these contexts. Recent research has suggested that OR51I2 may interact with certain ligands, potentially linking it to processes such as angiogenesis and cancer cell migration. The reorganization of OR51I2 into a recombinant protein format can facilitate structural and functional analyses, enabling researchers to explore its ligand-binding characteristics, signaling pathways, and possible therapeutic applications. Given the receptor's unique properties, the study of OR51I2 holds promise for uncovering novel insights into its biological roles and may pave the way for innovative strategies in treating diseases where its dysregulation is implicated.
