Analytical Data
-
Gene name
CCbL2
- Application
-
Alternative Names
CCbL2；CCBL2；KAT3；Kynurenine--oxoglutarate transaminase 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6YP21
-
Expression Region
1-454aa
-
AA Sequence
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
-
Molecular Weight
67.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCbL2, or C-C motif chemokine ligand 2, is a member of the CC chemokine family known for its critical role in various biological processes, including immune responses, inflammation, and tissue remodeling. The study of CCbL2 has gained significant attention due to its involvement in several pathological conditions, such as cancer, autoimmune diseases, and chronic inflammatory disorders. Research has shown that CCbL2 can influence the migration and activation of immune cells, thereby modulating the inflammatory response. The recombinant production of CCbL2 protein allows scientists to investigate its structural and functional properties in a controlled environment, facilitating the understanding of its mechanisms of action. Additionally, recombinant CCbL2 can be utilized in therapeutic applications, including the development of targeted drugs aimed at mitigating its pro-inflammatory effects. Understanding the role of CCbL2 at a molecular level not only provides insights into its physiological functions but also offers potential avenues for innovative treatments in inflammatory and immune-related diseases. As a result, ongoing research on recombinant CCbL2 continues to expand our knowledge of its biological significance and potential clinical applications.
