Cat: PA2000-9936

Recombinant Human OR4D1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR4D1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR4D1; OR4D3; Olfactory receptor 4D1; Olfactory receptor 4D3; Olfactory receptor TPCR16

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15615

  • Expression Region

    1-310 aa

  • AA Sequence

    MEPQNTTQVSMFVLLGFSQTQELQKFLFLLFLLVYVTTIVGNLLIMVTVTFDCRLHTPMY FLLRNLALIDLCYSTVTSPKMLVDFLHETKTISYQGCMAQIFFFHLLGGGTVFFLSVMAY DRYIAISQPLRYVTIMNTQLCVGLVVAAWVGGFVHSIVQLALILPLPFCGPNILDNFYCD VPQVLRLACTDTSLLEFLMISNSGLLVIIWFLLLLISYTVILVMLRSHSGKARRKAASTC TTHIIVVSMIFIPCIYIYTWPFTPFLMDKAVSISYTVMTPMLNPMIYTLRNQDMKAAMRR LGKCLVICRE

  • Molecular Weight

    35.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR4D1, a member of the olfactory receptor (OR) family, has garnered significant attention in recent years due to its potential roles beyond the traditional perception of smell. As one of the G-protein coupled receptors (GPCRs), OR4D1 is primarily expressed in the olfactory epithelium but is also found in various tissues, including the brain and immune cells, suggesting its involvement in diverse physiological processes. Research has revealed that OR4D1 may play a crucial role in modulating immune responses, influencing inflammatory pathways, and even impacting neuronal signaling. Moreover, its expression in non-olfactory tissues raises intriguing questions about the receptor's alternative functions, particularly in the context of cell signaling and intercellular communication. The study of OR4D1 recombinant protein has thus become essential for elucidating its pharmacological potential and therapeutic applications. By characterizing the binding affinities and signaling mechanisms of OR4D1, researchers hope to uncover novel insights into its ligand interactions and functional roles, which could lead to advancements in treating conditions related to immune dysregulation and neurodegenerative diseases. The ongoing exploration of OR4D1 not only deepens our understanding of the GPCR superfamily but also opens up new avenues for drug discovery and therapeutic innovation. As research progresses, the implications of OR4D1 in various biological contexts continue to expand, highlighting the receptor’s significance in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US