Analytical Data
-
Gene name
OR4D1
- Application
-
Alternative Names
OR4D1; OR4D3; Olfactory receptor 4D1; Olfactory receptor 4D3; Olfactory receptor TPCR16
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15615
-
Expression Region
1-310 aa
-
AA Sequence
MEPQNTTQVSMFVLLGFSQTQELQKFLFLLFLLVYVTTIVGNLLIMVTVTFDCRLHTPMY FLLRNLALIDLCYSTVTSPKMLVDFLHETKTISYQGCMAQIFFFHLLGGGTVFFLSVMAY DRYIAISQPLRYVTIMNTQLCVGLVVAAWVGGFVHSIVQLALILPLPFCGPNILDNFYCD VPQVLRLACTDTSLLEFLMISNSGLLVIIWFLLLLISYTVILVMLRSHSGKARRKAASTC TTHIIVVSMIFIPCIYIYTWPFTPFLMDKAVSISYTVMTPMLNPMIYTLRNQDMKAAMRR LGKCLVICRE
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4D1, a member of the olfactory receptor (OR) family, has garnered significant attention in recent years due to its potential roles beyond the traditional perception of smell. As one of the G-protein coupled receptors (GPCRs), OR4D1 is primarily expressed in the olfactory epithelium but is also found in various tissues, including the brain and immune cells, suggesting its involvement in diverse physiological processes. Research has revealed that OR4D1 may play a crucial role in modulating immune responses, influencing inflammatory pathways, and even impacting neuronal signaling. Moreover, its expression in non-olfactory tissues raises intriguing questions about the receptor's alternative functions, particularly in the context of cell signaling and intercellular communication. The study of OR4D1 recombinant protein has thus become essential for elucidating its pharmacological potential and therapeutic applications. By characterizing the binding affinities and signaling mechanisms of OR4D1, researchers hope to uncover novel insights into its ligand interactions and functional roles, which could lead to advancements in treating conditions related to immune dysregulation and neurodegenerative diseases. The ongoing exploration of OR4D1 not only deepens our understanding of the GPCR superfamily but also opens up new avenues for drug discovery and therapeutic innovation. As research progresses, the implications of OR4D1 in various biological contexts continue to expand, highlighting the receptor’s significance in health and disease.











