Analytical Data
-
Gene name
TCL6
- Application
-
Alternative Names
TCL6；Cytochrome c oxidase subunit 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56846
-
Expression Region
1-141aa
-
AA Sequence
MEPRVTQRKRPLDGCMGKITGITSDILKYDHKCFKLSLPAKFPEVCGSDEVFPDPDLLHV LPVAGSLQQSIDQCCLQLESLCRPGLLCAHPTLLFKLHSSMKNRPFFSLIYTYVKKTQQV RKRDRKPRGQVAAGPNPTSVM
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TCL6 is a gene associated with T-cell regulation and has garnered interest due to its potential implications in immune responses and various diseases, including autoimmune disorders and cancers. Research into TCL6 recombinant proteins aims to elucidate its functional roles within T-cell development and activation pathways. Investigating TCL6 can provide insights into how it modulates immune system responses, particularly in the context of T-cell differentiation and cytokine production. Furthermore, recombinant TCL6 proteins can serve as valuable tools for therapeutic applications, as they may help in the design of targeted treatments for diseases where the immune system plays a crucial role. As the understanding of TCL6's biological functions deepens, it may reveal novel pathways and mechanisms involved in immune regulation, opening avenues for innovative biomedical research and potential clinical interventions in immunological diseases.
