Cat: PA2000-9935

Recombinant Human OR4D11 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR4D11

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR4D11; OR4D11P; Olfactory receptor 4D11

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NGI4

  • Expression Region

    1-311 aa

  • AA Sequence

    MELGNVTRVKEFIFLGLTQSQDQSLVLFLFLCLVYMTTLLGNLLIMVTVTCESRLHTPMY FLLRNLAILDICFSSTTAPKVLLDLLSKKKTISYTSCMTQIFLFHLLGGADIFSLSVMAF DCYMAISKPLHYVTIMSRGQCTALISASWMGGFVHSIVQISLLLPLPFCGPNVLDTFYCD VPQVLKLTCTDTFALEFLMISNNGLVTTLWFIFLLVSYTVILMTLRSQAGGGRRKAISTC TSHITVVTLHFVPCIYVYARPFTALPTEKAISVTFTVISPLLNPLIYTLRNQEMKSAMRR LKRRLVPSERE

  • Molecular Weight

    34.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR4D11, a member of the olfactory receptor (OR) family, has garnered attention in recent years due to its potential role in odorant recognition and sensory biology. Olfactory receptors are integral to the perception of a wide array of smells, playing crucial roles in environmental interaction, behavioral responses, and even therapeutic applications. The OR4D11 gene, specifically, has been linked to the detection of certain volatile compounds, making it of interest for studies in both olfactory function and the molecular mechanisms underlying scent perception. Researchers are increasingly focused on the characterization and functional analysis of OR4D11, particularly through recombinant protein expression techniques. By obtaining the OR4D11 protein in a laboratory setting, scientists can investigate its binding properties, signal transduction pathways, and interactions with various ligands. This knowledge not only enhances our understanding of the olfactory system but also has implications for industries such as perfumery, food flavoring, and even the development of artificial olfactory devices. Moreover, studying OR4D11 can provide insights into genetic variations in olfactory capabilities among different populations, contributing to the broader field of sensory genetics. The advancement of techniques in protein engineering and molecular biology continues to facilitate exploration into the functional attributes of OR4D11, aiming to unravel the complexities of olfactory signaling and its evolutionary significance. Through these studies, we hope to uncover the intricate relationship between molecular structures of olfactory receptors and their behavioral implications, ultimately expanding our comprehension of human sensory experiences.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US