Analytical Data
-
Gene name
OR4D11
- Application
-
Alternative Names
OR4D11; OR4D11P; Olfactory receptor 4D11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGI4
-
Expression Region
1-311 aa
-
AA Sequence
MELGNVTRVKEFIFLGLTQSQDQSLVLFLFLCLVYMTTLLGNLLIMVTVTCESRLHTPMY FLLRNLAILDICFSSTTAPKVLLDLLSKKKTISYTSCMTQIFLFHLLGGADIFSLSVMAF DCYMAISKPLHYVTIMSRGQCTALISASWMGGFVHSIVQISLLLPLPFCGPNVLDTFYCD VPQVLKLTCTDTFALEFLMISNNGLVTTLWFIFLLVSYTVILMTLRSQAGGGRRKAISTC TSHITVVTLHFVPCIYVYARPFTALPTEKAISVTFTVISPLLNPLIYTLRNQEMKSAMRR LKRRLVPSERE
-
Molecular Weight
34.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4D11, a member of the olfactory receptor (OR) family, has garnered attention in recent years due to its potential role in odorant recognition and sensory biology. Olfactory receptors are integral to the perception of a wide array of smells, playing crucial roles in environmental interaction, behavioral responses, and even therapeutic applications. The OR4D11 gene, specifically, has been linked to the detection of certain volatile compounds, making it of interest for studies in both olfactory function and the molecular mechanisms underlying scent perception. Researchers are increasingly focused on the characterization and functional analysis of OR4D11, particularly through recombinant protein expression techniques. By obtaining the OR4D11 protein in a laboratory setting, scientists can investigate its binding properties, signal transduction pathways, and interactions with various ligands. This knowledge not only enhances our understanding of the olfactory system but also has implications for industries such as perfumery, food flavoring, and even the development of artificial olfactory devices. Moreover, studying OR4D11 can provide insights into genetic variations in olfactory capabilities among different populations, contributing to the broader field of sensory genetics. The advancement of techniques in protein engineering and molecular biology continues to facilitate exploration into the functional attributes of OR4D11, aiming to unravel the complexities of olfactory signaling and its evolutionary significance. Through these studies, we hope to uncover the intricate relationship between molecular structures of olfactory receptors and their behavioral implications, ultimately expanding our comprehension of human sensory experiences.











