Analytical Data
-
Gene name
OR2T8
- Application
-
Alternative Names
OR2T8; OR2T8P; Olfactory receptor 2T8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NH00
-
Expression Region
1-312 aa
-
AA Sequence
MENGSYTSYFILLGLFNHTRAHQVLFMMVLSIVLTSLFGNSLMILLIHWDHRLHTPMYFL LSQLSLMDVMLVSTTVPKMAADYLTGSKAISRAGCGAQIFFLPTLGGGECFLLAAMAYDR YAAVCHPLRYPTLMSWQLCLRMNLSCWLLGAADGLLQAVATLSFPYCGAHEIDHFFCETP VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLHMRSTEARKKAFATCS SHVAVVGLFYGAAIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVKNSEVKGALT RCMGRCVALSRE
-
Molecular Weight
34.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR2T8 protein, belonging to the olfactory receptor family, is a G protein-coupled receptor (GPCR) that plays a critical role in the sensory perception of smell. Receptors in this family are primarily located in the olfactory epithelium and are essential for the detection of volatile odorant molecules. Recent research has highlighted the significance of OR2T8 in not only olfactory signaling but also in various physiological processes outside of the olfactory system, including potential roles in immune responses and cancer biology. Recombination and expression studies of OR2T8 are crucial for understanding its structure-function relationships, signaling mechanisms, and the pathways involved in olfactory transduction. Advances in recombinant protein technology have enabled the production of OR2T8 in various expression systems, which facilitates the study of its ligand-binding properties and interaction with downstream signaling molecules. The exploration of OR2T8's function may provide insights into the molecular basis of olfaction and its implications in health and disease, thereby offering potential targets for therapeutic interventions in smell disorders and other related conditions. Continued research into OR2T8 is likely to yield significant findings that enhance our understanding of the complexities of the olfactory system and its broader biological implications.
