Cat: PA1000-3053

Recombinant Human STK3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    STK3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    STK3;KRS1;Serine/threonine-Protein kinase 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13188

  • Expression Region

    2-491aa

  • AA Sequence

    EQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQ VVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEY CGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGN ILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCV ADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDF TDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKR HEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMI EHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQD FKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMR LKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQNF

  • Molecular Weight

    78 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

STK3, also known as Serine/Threonine Kinase 3, is a member of the mitogen-activated protein kinase (MAPK) superfamily and plays a crucial role in cellular signaling pathways that regulate various biological processes, including cell growth, differentiation, and apoptosis. Research into STK3 has gained prominence due to its involvement in tumorigenesis and cancer progression, particularly in relation to its function as a mediator of stress responses and its potential role as a tumor suppressor. The study of recombinant STK3 protein has become essential for understanding its biochemical properties, regulatory mechanisms, and interactions with other signaling molecules. By expressing STK3 in a recombinant system, researchers aim to produce sufficient quantities of the protein for detailed structural and functional analyses. This knowledge is vital for elucidating STK3's role in various signaling cascades and its potential as a therapeutic target for cancer treatment. Additionally, understanding the modulation of STK3 activity could provide insights into novel strategies for the development of kinase inhibitors, which are increasingly being explored in the context of personalized medicine. Thus, recombinant STK3 protein serves as a pivotal tool in both basic and translational research aimed at unraveling the complex web of signaling networks that govern cellular behavior in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US