Cat: PA1000-3052

Recombinant Human STK17B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    STK17B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    STK17B;DRAK2;Serine/threonine-Protein kinase 17B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O94768

  • Expression Region

    1-372aa

  • AA Sequence

    MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQC ISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELAKSCPRVINLHEVY ENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLH QNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPE YLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQV NVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFEN LFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMV SKRFRFDDSLPNPHELVSDLLC

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

STK17B, or serine/threonine kinase 17B, is a member of the serine/threonine kinase family, which plays a significant role in various cellular processes, including apoptosis, autophagy, and stress response. Research on STK17B has gained attention due to its involvement in several pathological conditions, such as cancer, neurodegenerative diseases, and inflammatory disorders. The protein is known to interact with multiple signaling pathways, and its dysregulation may contribute to disease progression. Given this context, the study of STK17B recombinant proteins has become a crucial area of investigation, facilitating the understanding of its biological functions and potential as a therapeutic target. By producing STK17B in a recombinant form, researchers can examine its activity, structure-function relationships, and interactions with other cellular proteins in a controlled environment. This research not only enhances our knowledge of STK17B's biological role but also opens pathways for drug development aimed at modulating its activity. As a result, the exploration of STK17B recombinant proteins is essential for advancing our comprehension of its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US