Analytical Data
-
Gene name
AGTRL1
- Application
-
Alternative Names
APLNR; AGTRL1; APJ; Apelin receptor; Angiotensin receptor-like 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35414
-
Expression Region
1-380aa
-
AA Sequence
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
-
Molecular Weight
67.54 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AGTRL1 (angiotensin II receptor-like 1) is a G protein-coupled receptor that plays a crucial role in various physiological processes, including cardiovascular regulation and inflammation. Emerging evidence suggests that AGTRL1 is involved in mediating the effects of angiotensin II and other ligands, which are critical for maintaining blood pressure homeostasis. Research has indicated that dysregulation of AGTRL1 signaling may contribute to the pathogenesis of several diseases, including hypertension, heart failure, and certain inflammatory conditions. The recombination and expression of AGTRL1 protein in various model systems have enabled researchers to investigate its functional characteristics and interactions with other signaling pathways. Understanding the structural and functional properties of AGTRL1 can provide insights into its role in health and disease, potentially uncovering new therapeutic targets for cardiovascular and inflammatory disorders. As the research progresses, developing AGTRL1 recombinant proteins will facilitate high-throughput screenings for small molecule inhibitors or activators, paving the way for novel treatments that target AGTRL1-mediated signaling pathways.
