Analytical Data
-
Gene name
OR2T35
- Application
-
Alternative Names
OR2T35; Olfactory receptor 2T35; Olfactory receptor OR1-66
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGX2
-
Expression Region
1-323 aa
-
AA Sequence
MGMEGLLQNSTNFVLTGLITHPAFPGLLFAVVFSIFVVAITANLVMILLIHMDSRLHTPM YFLLSQLSIMDTIYICITVPKMLQDLLSKDKTISFLGCAVQIFYLTLIGGEFFLLGLMAY DRYVAVCNPLRYPLLMNRRVCLFMVVGSWVGGSLDGFMLTPVTMSFPFCRSREINHFFCE IPAVLKLSCTDTSLYETLMYACCVLMLLIPLSVISVSYTHILLTVHRMNSAEGRRKAFAT CSSHIMVVSVFYGAAFYTNVLPHSYHTPEKDKVVSAFYTILTPMLNPLIYSLRNKDVAAA LRKVLGRCGSSQSIRVATVIRKG
-
Molecular Weight
36.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2T35 is a member of the olfactory receptor (OR) gene family, which plays a crucial role in the sensory perception of smell in humans. This particular receptor is a G protein-coupled receptor (GPCR) that is expressed in the olfactory epithelium, where it is responsible for detecting various odorant molecules. Recent studies have highlighted the significance of olfactory receptors beyond the olfactory system, suggesting potential roles in various physiological processes, including immune response and cell signaling. Research into OR2T35 has gained attention due to its unique ligand specificity and the implications that its activation may have on sensory processing and behavioral responses. Understanding the molecular mechanisms of OR2T35 activation, signal transduction pathways, and its potential as a therapeutic target in conditions such as anosmia could offer innovative strategies for intervention. Additionally, recombinant expression of OR2T35 in model systems allows for in-depth functional assays and structure-activity relationship studies, providing insights into the design of synthetic odorants or antagonists. Thus, the investigation of OR2T35 represents a promising avenue for exploring the complexities of olfactory signaling and its broader biological implications.
