Analytical Data
-
Gene name
OR2T2
- Application
-
Alternative Names
OR2T2; OR2T2P; Olfactory receptor 2T2; Olfactory receptor OR1-43
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6IF00
-
Expression Region
1-324 aa
-
AA Sequence
MGMEGLLQNSTNFVLTGLITHPAFPGLLFAIVFSIFVVAITANLVMILLIHMDSRLHTPM YFLLSQLSIMDTIYICITVPKMLQDLLSKDKTISFLGCAVQIFLYLTLIGGEFFLLGLMA YDRYVAVCNPLRYPLLMNRRVCLFMVVGSWVGGSLDGFMLTPVTMSFPFCRSREINHFFC EIPAVLKLSCTDTSLYETLMYACCVLMLLIPLSVISVSYTHILLTVHRMNSAEGRRKAFA TCSSHIMVVSVFYGAAFYTNVLPHSYHTPEKDKVVSAFYTILTPMLNPLIYSLRNKDVAA ALRKVLGRCGSSQSIRVATVIRKG
-
Molecular Weight
36.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2T2 is a member of the olfactory receptor family, which plays a critical role in the sensory perception of odors. This receptor is primarily expressed in the olfactory epithelium, where it contributes to the complex process of odor detection and recognition. Recent studies have highlighted the importance of olfactory receptors beyond the sense of smell, suggesting that they may also be involved in various physiological processes and conditions such as metabolism and reproduction. The research surrounding OR2T2 has gained momentum as scientists explore its potential therapeutic applications, particularly in the context of diseases linked to olfactory dysfunction or metabolic disorders. However, the functional properties and binding mechanisms of OR2T2 remain inadequately understood, necessitating further investigation through recombinant protein expression and characterization. By generating and studying recombinant OR2T2 protein, researchers aim to elucidate its ligand interactions, signaling pathways, and the broader implications of its function in human health. This research not only enhances our understanding of olfactory signaling mechanisms but also opens avenues for novel treatments for conditions associated with olfactory receptor dysregulation, making OR2T2 an intriguing target for biochemical and pharmacological studies.
