Analytical Data
-
Gene name
OR2T27
- Application
-
Alternative Names
OR2T27; Olfactory receptor 2T27; Olfactory receptor OR1-67
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH04
-
Expression Region
1-317 aa
-
AA Sequence
MEQSNYSVYADFILLGLFSNARFPWLLFALILLVFLTSIASNVVKIILIHIDSRLHTPMY FLLSQLSLRDILYISTIVPKMLVDQVMSQRAISFAGCTAQHFLYLTLAGAEFFLLGLMSY DRYVAICNPLHYPVLMSRKICWLIVAAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCE VPALLKLSCTDTSAYETAMYVCCIMMLLIPFSVISGSYTRILITVYRMSEAEGRGKAVAT CSSHMVVVSLFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGA LQKVVGRCVSSGKVTTF
-
Molecular Weight
35.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR2T27 protein is a member of the olfactory receptor family, which plays a crucial role in the sensory perception of odors. These receptors are G protein-coupled receptors (GPCRs) primarily located in the olfactory epithelium of the nasal cavity, where they detect volatile compounds and transmit signals to the brain, facilitating the sense of smell. Research into OR2T27 has gained traction due to its potential implications in understanding olfactory signaling pathways and how genetic variations in olfactory receptors can influence human perception of scents. Recent studies have indicated that specific olfactory receptors, including OR2T27, may be involved in the detection of pheromones and environmental odors, which can affect behaviors such as mating and foraging in various species. Furthermore, exploring the structural and functional characteristics of OR2T27 has the potential to unveil novel therapeutic targets for olfactory dysfunction and other related disorders. Understanding the complexities of olfactory receptor interactions and mechanisms could also contribute to advancements in flavor and fragrance industries, as well as the development of more effective odor detection systems. Overall, the investigation of OR2T27 serves as a critical foundation for bridging the gap between sensory biology, genetics, and practical applications in both health and consumer science.
