Analytical Data
-
Gene name
AF1521
- Application
-
Alternative Names
AF1521；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O28751
-
Expression Region
1-192aa
-
AA Sequence
MEVLFEAKVGDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKACAGDAGLYTEISKKAMREQFGRDYIDHGEVVVTPAMNLEERGIKYVFHTVGPICSGMWSEELKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETFLEAVKNFKGSAVKEVALVIYDRKSAEVALKVFERSL
-
Molecular Weight
20.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AF1521 is a recombinant protein that has garnered attention due to its potential therapeutic applications, particularly in the context of autoimmune diseases and cancer treatment. This protein belongs to a class of biologics designed to mimic or enhance biological processes in the body. Researchers are focusing on AF1521 due to its unique structural properties and its ability to modulate immune responses. The background of this research is rooted in the increasing demand for targeted therapies that offer fewer side effects compared to conventional treatments. Studies have demonstrated that AF1521 can interact with specific immune pathways, leading to promising results in preclinical models. These findings underscore the importance of understanding the molecular mechanisms underlying its action, as well as optimizing its production and stability for clinical applications. Moreover, ongoing research aims to elucidate the potential of AF1521 in combination with other therapies, paving the way for more effective treatment strategies in various diseases. This growing body of evidence highlights the significance of AF1521 in the field of biomedicine and sets the stage for future clinical trials that will explore its efficacy and safety in human populations.
