Analytical Data
-
Gene name
OR2T29
- Application
-
Alternative Names
OR2T29; Olfactory receptor 2T29
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH02
-
Expression Region
1-315 aa
-
AA Sequence
MANITRMANHTGRLDFILMGLFRQSKHPALLSVVIFVVFLKALSGNAVLILLIHCDAHLH SPMYFFISQLSLMDMAYISVTVPKMLLDQVMGVNKVSAPECGMQMFLYLTLAGSEFFLLA TMAYDRYVAICHPLRYPVLMNHRVCLFLASGCWFLGSVDGFMLTPITMSFPFCRSWEIHH FFCEVPAVTILSCSDTSLYETLMYLCCVLMLLIPVTIISSSYLLILLTVHRMNSAEGRKK AFATCSSHLTVVILFYGAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKD VMGALKKMLTVRFVL
-
Molecular Weight
35.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2T29 is a member of the olfactory receptor gene family, which plays a crucial role in the sensation of smell. As one of the many G protein-coupled receptors, OR2T29 is involved in the detection of specific odorant molecules, contributing to the complexity and diversity of olfactory perception. Recent studies have indicated that olfactory receptors not only function in smell but may also play roles in various physiological processes, including neuronal signaling and even certain diseases. The exploration of OR2T29, particularly in the context of its structure and function, has garnered interest due to its potential implications in understanding the genetic basis of olfactory disorders and the development of novel therapeutic strategies. Additionally, the investigation of the recombinantly expressed OR2T29 protein allows researchers to elucidate its ligand-binding properties and signal transduction pathways, providing insights into how specific odors activate this receptor. Understanding OR2T29 at a molecular level could also enhance our knowledge of the broader olfactory receptor landscape and its interactions within the human genome, potentially leading to advancements in fields such as neurology, pharmacology, and sensory biology.
