Analytical Data
-
Gene name
OR2T10
- Application
-
Alternative Names
OR2T10; Olfactory receptor 2T10; Olfactory receptor OR1-64
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGZ9
-
Expression Region
1-312 aa
-
AA Sequence
MRLANQTLGGDFFLLGIFSQISHPGRLCLLIFSIFLMAVSWNITLILLIHIDSSLHTPMY FFINQLSLIDLTYISVTVPKMLVNQLAKDKTISVLGCGTQMYFYLQLGGAECCLLAAMAY DRYVAICHPLRYSVLMSHRVCLLLASGCWFVGSVDGFMLTPIAMSFPFCRSHEIQHFFCE VPAVLKLSCSDTSLYKIFMYLCCVIMLLIPVTVISVSYYYIILTIHKMNSVEGRKKAFTT CSSHITVVSLFYGAAIYNYMLPSSYQTPEKDMMSSFFYTILTPVLNPIIYSFRNKDVTRA LKKMLSVQKPPY
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2T10 is a member of the olfactory receptor (OR) gene family, which encodes proteins that play a crucial role in the detection of volatile odorant molecules. Research into OR2T10 is significant due to its potential involvement in the sensory perception of specific odors and its implications in human olfaction and behavior. The olfactory system is vital for various functions, including predator avoidance, food selection, and social interactions, making the study of olfactory receptors pertinent to understanding these processes at a molecular level. Recent advancements in molecular biology techniques have facilitated the expression and characterization of OR2T10 as a recombinant protein, enabling scientists to investigate its functional properties, signaling mechanisms, and interactions with different odorants. Additionally, exploring the variability and polymorphisms within the OR2T10 gene may shed light on individual differences in olfactory sensitivity and preferences, potentially linking genetic factors to sensory experiences. Through these studies, OR2T10 serves as a promising candidate for further research in the fields of sensory biology, genetic influence on perception, and even applications in the development of flavor and fragrance industries.
