Cat: PA1000-3043

Recombinant Human STBD1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    STBD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    STBD1;Starch-binding domain-containing Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95210

  • Expression Region

    24-358aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSRGGPGDTGKDGDAEQEKDAPLGGAAIP GGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRL QNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPM GEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDH EEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGK MERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLH YNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKV VHAWWGIH

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

STBD1 (Starch Binding Domain 1) is a protein that plays a crucial role in carbohydrate metabolism, particularly in the regulation of starch degradation and glucose homeostasis. It is characterized by its ability to bind to starch and other polysaccharides, facilitating their breakdown and subsequent utilization in energy metabolism. Research on STBD1 has gained attention due to its potential implications in understanding metabolic disorders, obesity, and diabetes. Studies have shown that STBD1 interacts with various enzymes involved in carbohydrate catabolism, influencing the rate of starch digestion and glucose release in the body. Given the rising prevalence of metabolic diseases worldwide, elucidating the mechanisms of STBD1 and its functional pathways presents a promising avenue for therapeutic interventions. Additionally, recombinant proteins of STBD1 have been produced for experimental purposes, enabling in-depth investigations into its structure-function relationships and the development of novel strategies for managing metabolic health. This burgeoning field of research not only enhances our comprehension of carbohydrate metabolism but also holds promise for innovative treatments aimed at improving glycemic control and metabolic efficiency.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US