Analytical Data
-
Gene name
OR2S2
- Application
-
Alternative Names
OR2S2; Olfactory receptor 2S2; Olfactory receptor OR9-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQN1
-
Expression Region
1-319 aa
-
AA Sequence
MEKANETSPVMGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMA FDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTC EILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFS TCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLR NKDVKAAVRRLLRPKGFTQ
-
Molecular Weight
35.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2S2, a member of the olfactory receptor family, has garnered interest in the field of receptor biology due to its unique role in the perception of specific odorant molecules. These receptors, which are G-protein-coupled receptors (GPCRs), play a pivotal role in the olfactory system, enabling organisms to detect and distinguish a vast array of scents. The study of OR2S2, in particular, is essential for understanding its ligands, signaling pathways, and potential physiological roles. Research has indicated that olfactory receptors like OR2S2 may not only be involved in the traditional sensory perception but could also exhibit functions in non-olfactory tissues, implicating them in various biological processes, including immune response and cell communication. Recombinant protein technology has become an invaluable tool in this research, allowing for the expression and purification of OR2S2 to study its structure-function relationships. By elucidating the mechanisms through which OR2S2 operates, researchers aim to provide insights into the broader implications of olfactory receptors in human health and disease, paving the way for novel therapeutic targets in conditions related to olfactory dysfunction and other receptor-mediated pathways. The ongoing investigation into OR2S2's characteristics enhances our understanding of GPCR biology and its potential applications in biotechnology and medicine.











