Analytical Data
-
Gene name
OR2M4
- Application
-
Alternative Names
OR2M4; Olfactory receptor 2M4; HTPCRX18; OST710; Olfactory receptor OR1-55; Olfactory receptor TPCR100
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96R27
-
Expression Region
1-311 aa
-
AA Sequence
MVWENQTFNSIFILLGIFNHSPTHTFLFSLVLGIFSLALMENISMVLLIYIEKQLHTPMY FLLSQLSLMDLMLICTTLPKMIFSYLSGKKSISLAGCGTQIFFYVSLLGAECFLLAVMAY DRYVAICHPLQYTILMNPKLCVFMTVASWTLGSLDGIIVLAAVLSFSYCSSLEIHHFFCD VAALLPLSCTETSAFERLLVICCVVMLIFPVSVIILSYSHVLRAVIHMGSGESRRKAFTT CSSHLSVVGLYYGAAMFMYMRPASKHTPDQDKMVSAFYTILTPMLNPLIYSLRNKEVFRA LQKVLKKRKLI
-
Molecular Weight
35.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR2M4 protein is part of the olfactory receptor family, specifically classified as a class A G-protein coupled receptor (GPCR), which plays a pivotal role in the sense of smell by detecting odorant molecules in the environment. Research into OR2M4 is significant because olfactory receptors are not only crucial for sensory perception but also involved in various physiological processes beyond smell, including potential roles in various diseases and conditions. Understanding the structure and function of OR2M4 could provide insights into the mechanisms of olfactory transduction and its implications in neurobiology and pharmacology. Moreover, recent studies suggest that olfactory receptors like OR2M4 may have novel functions in non-olfactory tissues, influencing areas such as tumor biology and neurological disorders. As the scientific community continues to explore the complexities of the olfactory receptor family, OR2M4 remains a target of interest due to its potential therapeutic applications and the opportunity it presents for advancing our understanding of GPCR signaling pathways. By investigating OR2M4, researchers aim not only to decipher its specific roles in olfaction but also its broader biological significance, which could lead to innovative approaches for addressing health issues linked to olfactory dysfunction and other related conditions.
