Cat: PA1000-3044

Recombinant Human STC2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    STC2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    STC2;Stanniocalcin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O76061

  • Expression Region

    25-302aa

  • AA Sequence

    TDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENN SCEIRGLHGICMTFLHNAGKFDAQGKSFIKDALKCKAHALRHRFGCISRK CPAIREMVSQLQRECYLKHDLCAAAQENTRVIVEMIHFKDLLLHEPYVDL VNLLLTCGEEVKEAITHSVQVQCEQNWGSLCSILSFCTSAIQKPPTAPPE RQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARG RVGGLGAQGPSGSSEWEDEQSEYSDIRRAAADYKDDDDK

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

STC2 (Stanniocalcin 2) is a protein that plays a significant role in various biological processes, including calcium homeostasis, hormonal regulation, and cellular responses to stress. Originally identified in fish, STC2 has been found to be conserved across multiple species, indicating its fundamental importance in physiological functions. Research into STC2 has expanded due to its implication in various diseases, particularly cancer, where it is involved in cell proliferation, survival, and metastatic processes. Furthermore, STC2 has been linked to inflammatory responses and has been suggested as a potential biomarker for certain pathologies. The ability to produce recombinant STC2 protein has opened avenues for in-depth studies of its structure-function relationships and interactions with other cellular components. Studies utilizing recombinant STC2 have provided insights into its role in modulating calcium signaling pathways and its potential therapeutic applications. Understanding STC2’s function and mechanism at the molecular level may pave the way for novel strategies in disease intervention and biomarker discovery, making it a focal point of ongoing research in molecular biology and medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US