Analytical Data
-
Gene name
OR2H1
- Application
-
Alternative Names
OR2H1; OR2H6; OR2H8; Olfactory receptor 2H1; Hs6M1-16; OLFR42A-9004.14/9026.2; Olfactory receptor 2H6; Olfactory receptor 2H8; Olfactory receptor 6-2; OR6-2; Olfactory receptor OR6-32
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZK4
-
Expression Region
1-316 aa
-
AA Sequence
MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIILLSVLYPRLHSPMYFF LSDLSFLDLCFTTSCVPQMLVNLWGPKKTISFLGCSVQLFIFLSLGTTECILLTVMAFDR YVAVCQPLHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQQIDDFLCEVP SLIRLSCGDTSYNEIQLAVSSVIFVVVPLSLILASYGATAQAVLRINSATAWRKAFGTCS SHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALR RLLGKERDSRESWRAA
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2H1 is a member of the olfactory receptor family, which plays a crucial role in the sensory perception of smell. Olfactory receptors are G protein-coupled receptors found in the olfactory epithelium and are pivotal for detecting a wide range of odorant molecules. OR2H1, specifically, is involved in recognizing volatile organic compounds, contributing to the complex signaling pathways that allow organisms to interpret olfactory stimuli. Research into this receptor is significant as it can provide insights into the molecular mechanisms underlying olfaction and its evolutionary implications. Moreover, understanding OR2H1's structure and function can have potential applications in fields such as flavoring, fragrance, and even disease diagnosis. The recombinant protein expression of OR2H1 in heterologous systems can facilitate detailed studies of its binding characteristics, signaling mechanisms, and interactions with other cellular pathways. Overall, the investigation of OR2H1 and its recombinant form holds promise for advancing our knowledge of sensory biology and its applications in various biotechnological domains.
