Cat: PA1000-3034

Recombinant Human STAC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    STAC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    STAC;STAC1;SH3 and cysteine-rich domain-containing Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99469

  • Expression Region

    1-402aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMIPPSSPREDGVDGLPKEAVGAEQPPS PASTSSQESKLQKLKRSLSFKTKSLRSKSADNFFQRTNSEDMKLQAHMVA EISPSSSPLPAPGSLTSTPARAGLHPGGKAHAFQEYIFKKPTFCDVCNHM IVGTNAKHGLRCKACKMSIHHKCTDGLAPQRCMGKLPKGFRRYYSSPLLI HEQFGCIKEVMPIACGNKVDPVYETLRFGTSLAQRTKKGSSGSGSDSPHR TSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQ GSLSKDPLQMNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKI QDRIGFFPANFVQRLQQNEKIFRCVRTFIGCKEQGQITLKENQICVSSEE EQDGFIRVLSGKKKGLIPLDVLENI

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

STAC (Signal Transduction and Activation of RNA) proteins are a family of signaling molecules that play a significant role in cancer biology and other cellular processes. They are known for their ability to interact with various signaling pathways, influencing gene expression and cellular responses. Recent studies have suggested that STAC proteins may serve as important regulators of cell growth, differentiation, and survival, particularly in the context of tumor development and progression. Research has shown that alterations in STAC protein expression can lead to dysregulation of these pathways, contributing to the transformation of normal cells into cancerous ones. Moreover, the potential of STAC proteins as therapeutic targets has garnered attention, as manipulating their function could provide new avenues for cancer treatment. Scientists are actively investigating the molecular mechanisms by which STAC proteins exert their effects, as well as their interactions with other cellular components. Understanding STAC protein dynamics and their role in disease could lead to the development of novel diagnostic and therapeutic strategies, ultimately improving patient outcomes in various malignancies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US