Analytical Data
-
Gene name
OR2G3
- Application
-
Alternative Names
OR2G3; Olfactory receptor 2G3; Olfactory receptor OR1-33
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGZ4
-
Expression Region
1-309 aa
-
AA Sequence
MGLGNESSLMDFILLGFSDHPRLEAVLFVFVLFFYLLTLVGNFTIIIISYLDPPLHTPMY FFLSNLSLLDICFTTSLAPQTLVNLQRPKKTITYGGCVAQLYISLALGSTECILLADMAL DRYIAVCKPLHYVVIMNPRLCQQLASISWLSGLASSLIHATFTLQLPLCGNHRLDHFICE VPALLKLACVDTTVNELVLFVVSVLFVVIPPALISISYGFITQAVLRIKSVEARHKAFST CSSHLTVVIIFYGTIIYVYLQPSDSYAQDQGKFISLFYTMVTPTLNPIIYTLRNKDMKEA LRKLLSGKL
-
Molecular Weight
34.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2G3 is a member of the olfactory receptor family, which plays a critical role in the perception of odorant molecules and has garnered significant interest in the fields of neuroscience and molecular biology. This receptor is primarily expressed in the olfactory epithelium and contributes to the sense of smell, but it has also been implicated in several physiological processes beyond olfaction, including potential roles in immune response and modulation of sensory pathways. Research into OR2G3 is particularly relevant as it may provide insights into the mechanisms of smell disorders and could offer targets for therapeutic interventions in sensory dysfunctions. Additionally, the recombinant expression of OR2G3 protein allows for the study of its structure and function in vitro, facilitating the exploration of its signaling pathways and interaction with ligands. As scientists continue to investigate OR2G3, understanding its detailed biological role may enhance our knowledge of sensory biology and contribute to advancements in olfactory research and its applications, including flavor and fragrance development, as well as potential implications in broader physiological contexts. This backdrop of ongoing research highlights the importance of OR2G3 as a distinct model for studying olfactory receptors and their complex roles in human health and disease.
