Cat: PA2000-5397

Recombinant Human AGPAT3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AGPAT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AGPAT3; LPAAT3; UNQ759/PRO1490; 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma; 1-acylglycerol-3-phosphate

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NRZ7

  • Expression Region

    1-43.3aa

  • AA Sequence

    MGSPAHLPKDAIAVFIVFPRVRHWLSGTRRQCTRRAPYVRCFKVPVLRKRSLVEEMSAEQITK

  • Molecular Weight

    33.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AGPAT3, or 1-Acylglycerol-3-Phosphate O-acyltransferase 3, is a crucial enzyme involved in lipid metabolism, particularly in the biosynthesis of glycerolipids. It catalyzes the acylation of lysophosphatidic acid to produce phosphatidic acid, a key precursor for the formation of triglycerides and phospholipids, thereby playing a significant role in cell membrane formation and energy storage. Recent studies have indicated that AGPAT3 is associated with various metabolic disorders, including obesity and insulin resistance, as it is implicated in the regulation of lipid accumulation in adipose tissue. Furthermore, its dysfunction has been linked to certain genetic conditions affecting lipid storage and utilization. Given the increasing prevalence of metabolic diseases worldwide, understanding the molecular mechanisms underlying AGPAT3’s function and regulation has become imperative. Researchers are focusing on characterizing AGPAT3 at the molecular level, assessing its activity and interaction with other metabolic pathways, and exploring its potential as a therapeutic target for ameliorating lipid-related disorders. This research not only aims to elucidate the enzyme's role in health and disease but also seeks to identify novel strategies for the management of metabolic syndrome through the modulation of AGPAT3 activity.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US