Analytical Data
-
Gene name
OR2G2
- Application
-
Alternative Names
OR2G2; Olfactory receptor 2G2; Olfactory receptor OR1-32
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGZ5
-
Expression Region
1-317 aa
-
AA Sequence
MGMVRHTNESNLAGFILLGFSDYPQLQKVLFVLILILYLLTILGNTTIILVSRLEPKLHM PMYFFLSHLSFLYRCFTSSVIPQLLVNLWEPMKTIAYGGCLVHLYNSHALGSTECVLPAV MSCDRYVAVCRPLHYTVLMHIHLCMALASMAWLSGIATTLVQSTLTLQLPFCGHRQVDHF ICEVPVLIKLACVGTTFNEAELFVASILFLIVPVSFILVSSGYIAHAVLRIKSATRRQKA FGTCFSHLTVVTIFYGTIIFMYLQPAKSRSRDQGKFVSLFYTVVTRMLNPLIYTLRIKEV KGALKKVLAKALGVNIL
-
Molecular Weight
35.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2G2 is a member of the olfactory receptor family, which plays a crucial role in odor detection and signal transduction in the olfactory system. With the growing interest in the therapeutic potential of olfactory receptors, research on OR2G2 has gained momentum due to its unique expression patterns and its implications in various physiological processes. Understanding the structure and function of OR2G2 can provide insights into its role in the sensory pathways and potentially unveil new mechanisms related to taste and smell disorders. Additionally, studies suggest that olfactory receptors may extend their influence beyond the sensory system, participating in processes like cell signaling and immune response. The recombinant expression of OR2G2 protein allows researchers to investigate its functional properties, binding affinities to different ligands, and integration into cellular systems. By employing advanced techniques such as crystallography and molecular modeling, scientists aim to elucidate the molecular basis of OR2G2's activity, which could lead to the development of novel therapeutic strategies targeting olfactory and non-olfactory dysfunctions. The exploration of OR2G2 and its recombinant protein variants not only contributes to our understanding of sensory biology but also holds promise for innovations in drug discovery and development.
