Analytical Data
-
Gene name
OR2D3
- Application
-
Alternative Names
OR2D3; Olfactory receptor 2D3; Olfactory receptor OR11-89
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGH3
-
Expression Region
1-330 aa
-
AA Sequence
MCSFFLCQTGKQAKISMGEENQTFVSKFIFLGLSQDLQTQILLFILFLIIYLLTVLGNQL IIILIFLDSRLHTPMYFFLRNLSFADLCFSTSIVPQVLVHFLVKRKTISFYGCMTQIIVF LLVGCTECALLAVMSYDRYVAVCKPLYYSTIMTQRVCLWLSFRSWASGALVSLVDTSFTF HLPYWGQNIINHYFCEPPALLKLASIDTYSTEMAIFSMGVVILLAPVSLILGSYWNIIST VIQMQSGEGRLKAFSTCGSHLIVVVLFYGSGIFTYMRPNSKTTKELDKMISVFYTAVTPM LNPIIYSLRNKDVKGALRKLVGRKCFSHRQ
-
Molecular Weight
37.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2D3 is a member of the olfactory receptor (OR) gene family, which plays a crucial role in the sense of smell by detecting a wide variety of odorant molecules. The study of OR2D3 and its recombinant protein is significant not only for understanding the mechanisms of olfactory signal transduction but also for potential applications in biomedical research and synthetic biology. Research indicates that receptors like OR2D3 are involved in various physiological processes, including neurodevelopment and disease. The ability to produce recombinant OR2D3 protein allows researchers to investigate its structure, ligand-binding properties, and functional mechanisms in detail. This can facilitate the study of olfactory dysfunctions and their links to neurological disorders as well as contribute to the development of novel diagnostic tools and therapeutic strategies. Additionally, the recombinant protein can be utilized in screening assays for identifying specific odorants and their interactions with the receptor, further expanding our understanding of olfactory receptor functionality. Overall, the research on OR2D3 recombinant protein represents a convergence of sensory biology, molecular pharmacology, and potential therapeutic innovation, highlighting the importance of olfactory receptors in both basic and applied sciences.
