Cat: PA1000-3027

Recombinant Human SSSCA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SSSCA1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZNRD2;SSSCA1;Protein ZNRD2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60232

  • Expression Region

    1-199aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMALNGAEVDDFSWEPPTEAETKVLQAR RERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYCVACQELD SDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEG AAAGLKAAQGPPAPAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETS IQLCGLIRACAEALRSLQQLQH

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The SSSCA1 (Slow Skeletal Muscle and Cardiac Isoform 1) protein has gained attention in the field of biomedical research due to its significant role in muscle physiology and potential implications in various muscular disorders. Initially identified in studies focusing on skeletal muscle function, SSSCA1 is believed to be involved in the regulation of muscle contraction and energy metabolism. Abnormalities in SSSCA1 expression have been associated with muscular dystrophies and other myopathies, highlighting its potential as a biomarker for muscle-related diseases. The increasing prevalence of such conditions necessitates a deeper understanding of the molecular mechanisms involving SSSCA1, which can pave the way for novel therapeutic strategies. Recent advancements in recombinant protein technology have enabled researchers to produce SSSCA1 in heterologous systems, facilitating in-depth studies of its structure and function. These studies aim to elucidate the protein's interaction with other muscle proteins, its post-translational modifications, and its role in muscle development and regeneration. Ultimately, characterizing SSSCA1 through recombinant protein research holds promise for advancing our knowledge of muscle biology and developing targeted interventions for muscular disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US