Analytical Data
-
Gene name
OR2C1
- Application
-
Alternative Names
OR2C1; OR2C2P; Olfactory receptor 2C1; OLFmf3; Olfactory receptor 2C2; Olfactory receptor OR16-1; Olfactory receptor OR16-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95371
-
Expression Region
1-312 aa
-
AA Sequence
MDGVNDSSLQGFVLMGISDHPQLEMIFFIAILFSYLLTLLGNSTIILLSRLEARLHTPMY FFLSNLSSLDLAFATSSVPQMLINLWGPGKTISYGGCITQLYVFLWLGATECILLVVMAF DRYVAVCRPLRYTAIMNPQLCWLLAVIACLGGLGNSVIQSTFTLQLPLCGHRRVEGFLCE VPAMIKLACGDTSLNQAVLNGVCTFFTAVPLSIIVISYCLIAQAVLKIRSAEGRRKAFNT CLSHLLVVFLFYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA LRRLLGKGREVG
-
Molecular Weight
34.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2C1, a member of the olfactory receptor (OR) gene family, has garnered research interest due to its unique role in the olfactory sensory system and potential relevance in other physiological processes. Unlike many other olfactory receptors, which are predominantly involved in detecting odors, OR2C1 has been implicated in the regulation of various cellular functions beyond olfaction. Studies suggest that OR2C1 may play a role in processes such as immune response modulation, cancer biology, and neuronal signaling. Additionally, the structural and functional characterization of OR2C1 is critical for understanding its mechanisms of action and potential therapeutic applications. The recombinant expression of OR2C1 allows researchers to investigate its binding interactions and downstream signaling pathways in controlled environments, thus providing insights into its biological significance. As research continues to unveil the intricacies of this receptor, OR2C1 stands out as a promising candidate for further exploration in the realms of pharmacology, neurology, and biochemistry, potentially leading to innovative strategies for disease treatment and modulation of sensory perception.
