Analytical Data
-
Gene name
OR1Q1
- Application
-
Alternative Names
OR1Q1; OR1Q2; OR1Q3; Olfactory receptor 1Q1; OST226; Olfactory receptor 1Q2; Olfactory receptor 1Q3; Olfactory receptor 9-A; OR9-A; Olfactory receptor OR9-25; Olfactory receptor TPCR106
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15612
-
Expression Region
1-314 aa
-
AA Sequence
MDNSNWTSVSHFVLLGISTHPEEQIPLFLVFSLMYAINISGNLAIITLILSAPRLHIPMY IFLSNLALTDICFTSTTVPKMLQIIFSPTKVISYTGCLAQTYFFICFAVMENFILAVMAY DRYIAICHPFHYTMILTRMLCVKMVVMCHALSHLHAMLHTFLIGQLIFCADNRIPHFFCD LYALMKISCTSTYLNTLMIHTEGAVVISGALAFITASYACIILVVLRIPSAKGRWKTFST CGSHLTVVAIFYGTLSWVYFRPLSSYSVTKGRIITVVYTVVTPMLNPFIYSLRNGDVKGG FMKWMSRMQTFFFR
-
Molecular Weight
35.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR1Q1 protein belongs to the olfactory receptor family, which plays a crucial role in the sensory perception of smell. Recently, research has highlighted the importance of olfactory receptors beyond their traditional role in the olfactory system, suggesting potential implications in various physiological processes and pathologies. Specifically, OR1Q1 has garnered attention for its unique expression patterns and potential involvement in neurological functions and immune responses. Studies have indicated that the activation of OR1Q1 may influence cellular signaling pathways, thereby impacting inflammation and neurodevelopment. Additionally, the exploration of OR1Q1 as a potential therapeutic target has been fueled by growing evidence linking olfactory receptors to drug discovery and development. Understanding the structure and function of OR1Q1 through recombinant protein technology could pave the way for innovative treatments in olfactory-related disorders and other diseases influenced by receptor signaling. Overall, research on OR1Q1 and similar receptors could significantly contribute to the fields of sensory biology, pharmacology, and therapeutic development, highlighting the intricate connections between sensory perception and broader biological functions.
